GET /api/protein/370/
HTTP 200 OK
Allow: GET, HEAD, OPTIONS
Content-Type: application/json
Vary: Accept

{
    "entry_nr": 370,
    "entry_url": "https://omabrowser.org/api/protein/370/",
    "omaid": "HEIAB00370",
    "canonicalid": "A0A2U3CJU7",
    "sequence_md5": "6541e7c81d8da1aae91fcad1092d0706",
    "oma_group": 65,
    "oma_hog_id": "HOG:0019590.1b",
    "chromosome": "NJBF01000003",
    "locus": {
        "start": 34634,
        "end": 36376,
        "strand": 1
    },
    "is_main_isoform": true,
    "roothog_id": 19590,
    "hog_levels": [
        "Archaea"
    ],
    "sequence_length": 580,
    "sequence": "MKPSSRIITSSFLLLMALSLLKGQMIQGYTNFSVEILNPTSIERTWNDLSLLYQNQYHTPEEVIAELYQLNETAPDLVNLTVLGQSIQGRDIHLVTITNEQITTPKAGVCIISQHHAREQISMEAALRFMIRLVNSYGKDEALTHYVNTEEIYIIPTLNPDGLHYVVGNDTMEGDPWLRKNLRAIDDDNDGECDEDPYNDVDGDGIISGYDVFGKGLSDLHFMYSYYEGIDDDGDGRVNEDLIGGTDLNRNYDYRWNDSSLDTGTGSDALSETFPGFSPFSEPETQIICDFMTSHSFSMAMSLHSGINTTYFPWASGSTWAQSDRYHDIYTDLKSRLPIYFFDDYLRAGLYPTSTQSIAYTSAGEWGDWAYATQGVQVPMTFEIYHKAGSEEYVAVEFENLTHKIFRFDTIEEYFAPPEGKIDALWFDILPAFDYWLETTPQLEVASLTVIGNNSEGAELTIKFKIKNTSPRVTTIAEVGVFDEHLIPFSGTEGIVVFSKLIEGESLSGSFKTILNHELGVNEEFKLFIGNNFVGFYPMIIKQSIIKKATGYFDLIGFLLAIPVVVMLKRRKTSVKLAGC",
    "cdna": "ATGAAACCTTCCTCACGAATAATAACCTCTTCTTTTCTTCTACTTATGGCACTTAGCCTATTAAAGGGTCAAATGATTCAAGGATATACAAATTTCTCCGTTGAAATCTTGAATCCTACCTCTATTGAACGTACATGGAATGATCTTTCATTATTATATCAGAATCAATATCATACCCCTGAAGAAGTTATTGCTGAGCTTTATCAACTAAACGAAACTGCTCCAGATCTTGTGAATTTGACTGTTTTGGGTCAAAGTATTCAAGGACGTGATATTCATTTGGTTACAATTACAAATGAGCAGATTACTACACCTAAAGCAGGAGTGTGCATCATTAGCCAACACCATGCACGAGAGCAAATCTCAATGGAAGCAGCACTCCGGTTTATGATTCGATTAGTCAATAGCTATGGTAAAGATGAGGCACTAACTCATTACGTCAATACAGAAGAGATCTATATAATACCCACATTGAATCCTGATGGACTGCATTATGTTGTAGGTAATGATACGATGGAAGGGGATCCTTGGTTACGGAAGAATCTCAGAGCTATCGATGATGATAATGATGGGGAATGTGATGAGGATCCGTACAACGATGTAGACGGTGATGGAATAATTTCGGGTTACGATGTATTTGGGAAGGGTTTATCGGATTTGCATTTCATGTATTCGTACTATGAGGGTATAGATGACGATGGAGATGGCAGGGTGAATGAAGATCTTATTGGTGGTACTGATTTAAATCGAAATTACGATTATAGGTGGAACGACTCCTCCTTGGATACAGGTACAGGATCTGATGCACTCTCCGAAACGTTCCCAGGATTTTCTCCATTCTCCGAACCAGAAACGCAAATAATATGTGATTTTATGACAAGTCATTCTTTTAGTATGGCAATGTCACTCCATTCTGGTATAAACACAACCTATTTCCCGTGGGCCTCAGGTTCGACTTGGGCCCAATCTGATCGCTATCATGATATTTACACAGATCTTAAGTCGAGATTACCCATTTATTTTTTTGATGATTATTTAAGAGCAGGATTGTATCCCACCTCAACTCAAAGTATCGCTTATACTAGTGCTGGAGAATGGGGAGATTGGGCTTACGCAACCCAAGGAGTACAAGTACCCATGACATTCGAGATCTATCATAAAGCAGGGTCAGAAGAGTATGTTGCTGTGGAATTTGAAAATCTTACTCATAAAATTTTCCGATTCGATACCATAGAGGAGTATTTTGCCCCACCTGAGGGTAAGATTGACGCCTTATGGTTTGATATTCTTCCAGCTTTTGATTACTGGCTTGAAACAACTCCTCAATTGGAAGTCGCTAGTTTAACTGTAATTGGAAATAATTCTGAGGGAGCAGAACTTACAATTAAATTCAAGATAAAAAATACGAGTCCACGTGTAACTACCATTGCAGAAGTGGGTGTTTTTGATGAGCATTTAATACCTTTTAGCGGTACTGAAGGAATAGTGGTCTTTAGTAAGCTTATCGAAGGTGAGTCATTATCTGGTTCATTTAAAACCATTTTAAATCATGAACTAGGTGTCAATGAAGAATTTAAACTATTTATAGGAAATAATTTTGTTGGATTTTATCCTATGATTATTAAACAGTCAATTATAAAAAAAGCTACTGGTTATTTTGATTTAATTGGTTTTTTACTTGCTATTCCAGTCGTAGTGATGCTGAAACGGAGAAAAACTTCCGTCAAACTAGCTGGTTGCTGA",
    "domains": "https://omabrowser.org/api/protein/370/domains/",
    "xref": "https://omabrowser.org/api/protein/370/xref/",
    "orthologs": "https://omabrowser.org/api/protein/370/orthologs/",
    "homoeologs": null,
    "gene_ontology": "https://omabrowser.org/api/protein/370/gene_ontology/",
    "oma_group_url": "https://omabrowser.org/api/group/65/",
    "oma_hog_members": "https://omabrowser.org/api/hog/HOG:0019590.1b/members/",
    "alternative_isoforms_urls": []
}