GET /api/protein/34224/
HTTP 200 OK
Allow: GET, HEAD, OPTIONS
Content-Type: application/json
Vary: Accept

{
    "entry_nr": 34224,
    "entry_url": "https://omabrowser.org/api/protein/34224/",
    "omaid": "FERFK00082",
    "canonicalid": "H9ZZC3",
    "sequence_md5": "c9bfcd50caaf879c1ef7bbcd009292e9",
    "oma_group": 99,
    "oma_hog_id": "HOG:0005475",
    "chromosome": "A",
    "locus": {
        "start": 78889,
        "end": 79380,
        "strand": -1
    },
    "is_main_isoform": true,
    "roothog_id": 5475,
    "hog_levels": [
        "Thermoprotei"
    ],
    "sequence_length": 163,
    "sequence": "MSQEGEGIPEEKGERRSRKGKERGISEIVSVMALLLIAVVAVFALRGWLSTQQSRMTNIDMATASYSVQTTFSGYVISLDVRNNLQGNLAVNQVQVILSNGTALSFSATGITPALPNTISAKSDQIYVITVNAGSGVAVKQINVRVQEPISLQSQWITAIGGG",
    "cdna": "ATGTCCCAGGAAGGCGAAGGTATTCCAGAGGAAAAGGGTGAGAGAAGGTCGAGGAAAGGAAAGGAGAGGGGAATCAGCGAGATCGTTTCCGTAATGGCCCTGCTCCTCATCGCTGTCGTTGCCGTATTCGCACTGAGGGGGTGGCTGTCAACGCAACAAAGCAGGATGACTAACATAGATATGGCTACAGCTAGCTACAGCGTCCAAACGACCTTCAGCGGATATGTCATCTCTCTGGACGTCAGGAACAACCTGCAGGGCAACCTCGCCGTGAACCAGGTCCAGGTAATTCTGAGCAACGGTACAGCTCTTTCCTTCTCTGCAACGGGGATAACCCCCGCTCTTCCTAACACGATATCAGCGAAGAGCGACCAGATCTACGTGATAACTGTCAATGCTGGGAGCGGGGTGGCTGTGAAGCAGATCAACGTCCGGGTCCAGGAACCAATTTCATTGCAGTCTCAGTGGATAACTGCAATAGGGGGAGGTTGA",
    "domains": "https://omabrowser.org/api/protein/34224/domains/",
    "xref": "https://omabrowser.org/api/protein/34224/xref/",
    "orthologs": "https://omabrowser.org/api/protein/34224/orthologs/",
    "homoeologs": null,
    "gene_ontology": "https://omabrowser.org/api/protein/34224/gene_ontology/",
    "oma_group_url": "https://omabrowser.org/api/group/99/",
    "oma_hog_members": "https://omabrowser.org/api/hog/HOG:0005475/members/",
    "alternative_isoforms_urls": []
}