GET /api/protein/26040/
HTTP 200 OK
Allow: GET, HEAD, OPTIONS
Content-Type: application/json
Vary: Accept

{
    "entry_nr": 26040,
    "entry_url": "https://omabrowser.org/api/protein/26040/",
    "omaid": "STAMF01459",
    "canonicalid": "A3DPL3",
    "sequence_md5": "d2385ede48e50bad9301ab24392692b0",
    "oma_group": 56,
    "oma_hog_id": "HOG:0001315",
    "chromosome": "Chromosome",
    "locus": {
        "start": 1456336,
        "end": 1456755,
        "strand": 1
    },
    "is_main_isoform": true,
    "roothog_id": 1315,
    "hog_levels": [
        "Staphylothermus",
        "Desulfurococcaceae"
    ],
    "sequence_length": 139,
    "sequence": "MSELLDLAKRMVKAFRTFECFVFEKEEIDKVRELLVQADIRSLVRIRKADPRYPYIYVVVPWSREFENICVSRVKKMLAEGRIDRETYNKRYNEMITQCIRHYERERVKEIIEKLERYIGKGSGGGFGGKTTIFPLEFP",
    "cdna": "ATGAGTGAACTTCTCGATCTAGCTAAGAGAATGGTTAAAGCTTTCAGGACTTTTGAATGCTTTGTTTTCGAGAAGGAAGAGATCGATAAGGTTAGAGAGCTCTTGGTTCAAGCTGATATTAGAAGTCTTGTCAGGATAAGAAAAGCTGATCCAAGATATCCATATATATACGTAGTTGTTCCCTGGAGTAGGGAGTTTGAGAATATATGTGTGTCTAGAGTTAAGAAGATGCTTGCTGAGGGAAGAATTGATCGGGAGACATATAATAAGAGATATAATGAGATGATCACTCAGTGTATTAGGCATTATGAGAGGGAGAGGGTAAAAGAAATTATTGAGAAACTAGAAAGATATATTGGTAAAGGCTCAGGTGGAGGTTTTGGAGGAAAAACTACTATCTTTCCCCTCGAATTCCCGTAA",
    "domains": "https://omabrowser.org/api/protein/26040/domains/",
    "xref": "https://omabrowser.org/api/protein/26040/xref/",
    "orthologs": "https://omabrowser.org/api/protein/26040/orthologs/",
    "homoeologs": null,
    "gene_ontology": "https://omabrowser.org/api/protein/26040/gene_ontology/",
    "oma_group_url": "https://omabrowser.org/api/group/56/",
    "oma_hog_members": "https://omabrowser.org/api/hog/HOG:0001315/members/",
    "alternative_isoforms_urls": []
}