GET /api/protein/18547/?format=api
HTTP 200 OK
Allow: GET, HEAD, OPTIONS
Content-Type: application/json
Vary: Accept

{
    "entry_nr": 18547,
    "entry_url": "https://omabrowser.org/api/protein/18547/?format=api",
    "omaid": "DESM000273",
    "canonicalid": "E8R7W6",
    "sequence_md5": "ea1b48b2bfa54362fe2d40406af8bc25",
    "sequence_length": 125,
    "species": {
        "code": "DESM0",
        "taxon_id": 765177,
        "species": "Desulfurococcus mucosus (strain ATCC 35584 / DSM 2162 / JCM 9187 / O7/1)",
        "genome_url": "https://omabrowser.org/api/genome/DESM0/?format=api"
    },
    "oma_group": 56,
    "oma_hog_id": "HOG:0001315",
    "chromosome": "A",
    "locus": {
        "start": 256896,
        "end": 257273,
        "strand": -1
    },
    "is_main_isoform": true,
    "roothog_id": 1315,
    "hog_levels": [
        "Desulfurococcus",
        "Desulfurococcaceae"
    ],
    "sequence": "MSAVNLAERVMKSFSRYNCFIFEESELQAVKDLIVAAELKGLIEIRQLDPRYPYIYVATVWTKSIERDCVTQVNNLLSEGRLTQEEYKKYRVELVEQCMVSREIEAAKRVVEALGRYIERLGRVG",
    "cdna": "GTGAGCGCGGTAAACCTGGCTGAACGCGTGATGAAGTCTTTTTCAAGGTACAACTGCTTTATATTCGAGGAAAGCGAGCTCCAAGCAGTCAAGGATCTCATCGTGGCAGCCGAGTTAAAGGGGCTCATTGAGATTAGGCAGCTGGATCCAAGGTACCCGTACATATATGTGGCAACCGTTTGGACCAAGAGCATTGAAAGAGACTGCGTGACACAGGTGAACAACCTGCTCTCCGAGGGGAGGCTTACCCAGGAGGAATACAAGAAGTACAGGGTTGAACTAGTTGAGCAATGCATGGTTAGCAGGGAGATCGAGGCGGCTAAAAGGGTTGTGGAGGCGCTCGGCAGGTATATTGAGAGACTGGGGAGAGTGGGCTGA",
    "domains": "https://omabrowser.org/api/protein/18547/domains/?format=api",
    "xref": "https://omabrowser.org/api/protein/18547/xref/?format=api",
    "orthologs": "https://omabrowser.org/api/protein/18547/orthologs/?format=api",
    "homoeologs": null,
    "gene_ontology": "https://omabrowser.org/api/protein/18547/gene_ontology/?format=api",
    "oma_group_url": "https://omabrowser.org/api/group/56/?format=api",
    "oma_hog_members": "https://omabrowser.org/api/hog/HOG:0001315/members/?format=api",
    "isoforms": "https://omabrowser.org/api/protein/18547/isoforms/?format=api",
    "alternative_isoforms_urls": []
}