GET /api/protein/18411/
HTTP 200 OK
Allow: GET, HEAD, OPTIONS
Content-Type: application/json
Vary: Accept

{
    "entry_nr": 18411,
    "entry_url": "https://omabrowser.org/api/protein/18411/",
    "omaid": "DESM000137",
    "canonicalid": "E8R723",
    "sequence_md5": "b2acf7e0d9fcafadd16576b4e28ef549",
    "oma_group": 89,
    "oma_hog_id": "HOG:0001705",
    "chromosome": "A",
    "locus": {
        "start": 130996,
        "end": 131868,
        "strand": 1
    },
    "is_main_isoform": true,
    "roothog_id": 1705,
    "hog_levels": [
        "Desulfurococcus",
        "Desulfurococcaceae"
    ],
    "sequence_length": 290,
    "sequence": "MQFICKASSAYCYMVDSMLKALGLTPLRTTGGEQPVGNIVFYAGRIDGELEGFLNSVAGHGLRVIIGVEHGGVVEKRVLKKIINIRRAGLEILVTASTMKDYRVLREEMPDVNVVYIPLHAPGSSVMRDLLPSDGGIATHSDECGRIVEVAGELEAVGFNPLIVNFSEKECSASSPWVINVATDSVFNLSSRIVIGVILDESASSYMVFDALYRNSRPLIVCSDMDIPVDSQMVIKTGRCSVDELASTIISLFSRIEYYRRIGSERPASTVAGRGMDALKEFIDGMRRQV",
    "cdna": "ATGCAGTTCATCTGTAAGGCCTCATCAGCGTACTGCTACATGGTTGACAGCATGTTGAAAGCCCTAGGCCTCACCCCCTTGAGGACGACTGGAGGCGAGCAACCCGTAGGCAACATAGTCTTCTACGCTGGCAGGATCGACGGGGAGCTCGAAGGCTTCCTCAACAGTGTGGCAGGACACGGGTTGAGGGTAATTATAGGTGTGGAGCACGGTGGTGTGGTTGAGAAGAGGGTTTTGAAGAAGATAATCAACATACGTAGAGCAGGCCTCGAGATACTGGTTACGGCTTCAACGATGAAGGATTACAGGGTTCTCAGGGAGGAGATGCCTGATGTAAACGTCGTCTACATCCCCCTCCATGCCCCTGGCTCTAGCGTCATGAGGGATCTGCTGCCAAGCGATGGCGGTATAGCCACGCATAGCGATGAATGCGGGAGGATAGTGGAGGTTGCAGGAGAGCTGGAAGCCGTGGGTTTCAACCCCCTGATAGTGAACTTCTCTGAGAAGGAGTGCAGTGCATCCTCCCCGTGGGTGATCAATGTTGCAACCGATAGCGTGTTCAACCTATCCTCCCGTATAGTCATAGGTGTAATACTCGACGAGAGTGCGTCGAGCTACATGGTGTTCGATGCACTATACAGGAACTCCCGCCCGCTCATAGTTTGCAGCGACATGGATATCCCAGTCGACTCCCAGATGGTGATCAAGACCGGTAGATGCAGCGTCGACGAGCTTGCATCCACCATAATATCGTTGTTCAGTAGGATCGAGTATTACAGGAGGATAGGCTCTGAGCGACCAGCGAGTACGGTGGCGGGTAGAGGCATGGATGCATTAAAGGAGTTCATTGATGGCATGCGTCGACAGGTGTAG",
    "domains": "https://omabrowser.org/api/protein/18411/domains/",
    "xref": "https://omabrowser.org/api/protein/18411/xref/",
    "orthologs": "https://omabrowser.org/api/protein/18411/orthologs/",
    "homoeologs": null,
    "gene_ontology": "https://omabrowser.org/api/protein/18411/gene_ontology/",
    "oma_group_url": "https://omabrowser.org/api/group/89/",
    "oma_hog_members": "https://omabrowser.org/api/hog/HOG:0001705/members/",
    "alternative_isoforms_urls": []
}